PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_230A3A2D0.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 251aa    MW: 27884.5 Da    PI: 9.615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_230A3A2D0.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.5e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEde+l+  ++++G g+W++ +++ g+ R++k+c++rw +yl
  Traes_2BL_230A3A2D0.2 14 KGPWTPEEDEKLLAHIEEHGHGSWRALPSKAGLQRCGKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding50.64.3e-1667112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg+++ +E++ +++++++lG++ W++Ia ++  +Rt++++k++w+++l
  Traes_2BL_230A3A2D0.2  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLS-RRTDNEIKNYWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.326961IPR017930Myb domain
SuperFamilySSF466891.27E-2911108IPR009057Homeodomain-like
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
PfamPF002493.6E-161461IPR001005SANT/Myb domain
CDDcd001676.58E-121661No hitNo description
PROSITE profilePS5129424.27162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2565116IPR009057Homeodomain-like
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002494.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.19E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRSLCCDKV GLKKGPWTPE EDEKLLAHIE EHGHGSWRAL PSKAGLQRCG KSCRLRWTNY  60
LQPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLSRRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKAAS GAPVGTADDV RSAKAAASLS HMAQWESARL EAEGRLARES TMRAAASRPT  180
SVPLHPINLP EPALESPTST LTFIGNNNSV SLGISEGDPT TWRLRGDDPE REEDSARRFL  240
RQQQMQGLEG A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
1h8a_C5e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486510.0AK248651.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf180h20, mRNA sequence.
GenBankAK3583250.0AK358325.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1073M23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574525.11e-129PREDICTED: myb-related protein Myb4-like
SwissprotQ9SPG25e-66MYB28_ARATH; Transcription factor MYB28
TrEMBLW5B7Q90.0W5B7Q9_WHEAT; Uncharacterized protein
STRINGMLOC_58915.41e-141(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-103myb domain protein 16
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]